IDI1 antibody (Middle Region)
-
- Target See all IDI1 Antibodies
- IDI1 (Isopentenyl-Diphosphate delta Isomerase 1 (IDI1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This IDI1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- IDI1 antibody was raised against the middle region of IDI1
- Purification
- Affinity purified
- Immunogen
- IDI1 antibody was raised using the middle region of IDI1 corresponding to a region with amino acids PLSNPAELEESDALGVRRAAQRRLKAELGIPLEEVPPEEINYLTRIHYKA
- Top Product
- Discover our top product IDI1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
IDI1 Blocking Peptide, catalog no. 33R-7208, is also available for use as a blocking control in assays to test for specificity of this IDI1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IDI1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- IDI1 (Isopentenyl-Diphosphate delta Isomerase 1 (IDI1))
- Alternative Name
- IDI1 (IDI1 Products)
- Background
- IDI1 is a peroxisomally-localized enzyme that catalyzes the interconversion of isopentenyl diphosphate (IPP) to its highly electrophilic isomer, dimethylallyl diphosphate (DMAPP), which are the substrates for the successive reaction that results in the synthesis of farnesyl diphosphate and, ultimately, cholesterol. It has been shown in peroxisomal deficiency diseases such as Zellweger syndrome and neonatal adrenoleukodystrophy that there is reduction in IPP isomerase activity.
- Molecular Weight
- 32 kDa (MW of target protein)
-