COPG2 antibody (N-Term)

Catalog No. ABIN632404

This Rabbit Polyclonal antibody specifically detects COPG2 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for COPG2 antibody (N-Term) (ABIN632404)

Target: COPG2 (Coatomer Protein Complex, Subunit gamma 2 (COPG2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This COPG2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-COPG2 Antibody

Binding Specificity: N-Term

Specificity: COPG2 antibody was raised against the N terminal of COPG2

Purification: Affinity purified

Immunogen: COPG2 antibody was raised using the N terminal of COPG2 corresponding to a region with amino acids MIKKFDKKDEESGSGSNPFQHLEKSAVLQEARIFNETPINPRRCLHILTK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

COPG2 Blocking Peptide, (ABIN5612963), is also available for use as a blocking control in assays to test for specificity of this COPG2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COPG2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for COPG2

Target: COPG2 (Coatomer Protein Complex, Subunit gamma 2 (COPG2))

Alternative Name: COPG2

Background: The coatomer is a cytosolic protein complex that binds to dilysine motifs and reversibly associates with Golgi non-clathrin-coated vesicles, which further mediate biosynthetic protein transport from the ER, via the Golgi up to the trans Golgi network.

Molecular Weight: 97 kDa (MW of target protein)