AHCYL1 antibody (N-Term)

Catalog No. ABIN632455

This Rabbit Polyclonal antibody specifically detects AHCYL1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for AHCYL1 antibody (N-Term) (ABIN632455)

Target: AHCYL1 (Adenosylhomocysteinase-Like 1 (AHCYL1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This AHCYL1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-AHCYL1 Antibody

Binding Specificity: N-Term

Specificity: AHCYL1 antibody was raised against the N terminal of AHCYL1

Purification: Affinity purified

Immunogen: AHCYL1 antibody was raised using the N terminal of AHCYL1 corresponding to a region with amino acids TDSYSSAASYTDSSDDEVSPREKQQTNSKGSSNFCVKNIKQAEFGRREIE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

AHCYL1 Blocking Peptide, (ABIN5611979), is also available for use as a blocking control in assays to test for specificity of this AHCYL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AHCYL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for AHCYL1

Target: AHCYL1 (Adenosylhomocysteinase-Like 1 (AHCYL1))

Alternative Name: AHCYL1

Background: The protein, an inositol 1,4,5-trisphosphate receptor-binding protein, specifically binds to and activates pancreas-type Na+/HCO3- cotransporter 1 (pNBC1).

Molecular Weight: 59 kDa (MW of target protein)