TGM4 antibody

Catalog No. ABIN632497

Product Details anti-TGM4 Antibody

Target: TGM4 (Transglutaminase 4 (Prostate) (TGM4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TGM4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Transglutaminase 4 antibody was raised using a synthetic peptide corresponding to a region with amino acids KEDMVFMPDEDERKEYILNDTGCHYVGAARSIKCKPWNFGQFEKNVLDCC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Transglutaminase 4 Blocking Peptide, catalog no. 33R-4320, is also available for use as a blocking control in assays to test for specificity of this Transglutaminase 4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TGM4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TGM4

Target: TGM4 (Transglutaminase 4 (Prostate) (TGM4))

Alternative Name: Transglutaminase 4 (TGM4 Products)

Synonyms: LOC100227373 antibody, TGP antibody, hTGP antibody, 9530008N10Rik antibody, Eapa1 antibody, Dp1 antibody, transglutaminase 4 antibody, transglutaminase 4 (prostate) antibody, TGM4 antibody, Tgm4 antibody

Background: TGM4 is associated with the mammalian reproductive process. TGM4 catalyzes the cross-linking of proteins and the conjugation of polyamines to specific proteins in the seminal tract.

Molecular Weight: 77 kDa (MW of target protein)