ARHGAP28 antibody (N-Term)

Catalog No. ABIN632516

The Rabbit Polyclonal anti-ARHGAP28 antibody has been validated for WB. It is suitable to detect ARHGAP28 in samples from Human.

Quick Overview for ARHGAP28 antibody (N-Term) (ABIN632516)

Target: ARHGAP28 (rho GTPase Activating Protein 28 (ARHGAP28))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARHGAP28 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ARHGAP28 Antibody

Binding Specificity: N-Term

Specificity: ARHGAP28 antibody was raised against the N terminal of ARHGAP28

Purification: Affinity purified

Immunogen: ARHGAP28 antibody was raised using the N terminal of ARHGAP28 corresponding to a region with amino acids KEGSFAVPRSDSVAILETIPVLPVHSNGSPEPGQPVQNAISDDDFLEKNI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARHGAP28 Blocking Peptide, (ABIN939720), is also available for use as a blocking control in assays to test for specificity of this ARHGAP28 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGAP28 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARHGAP28

Target: ARHGAP28 (rho GTPase Activating Protein 28 (ARHGAP28))

Alternative Name: ARHGAP28

Background: ARHGAP28 contains 1 Rho-GAP domain. ARHGAP28 is a GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.

Molecular Weight: 63 kDa (MW of target protein)