CLPB antibody

Catalog No. ABIN632528

The Rabbit Polyclonal anti-CLPB antibody has been validated for WB. It is suitable to detect CLPB in samples from Human.

Quick Overview for CLPB antibody (ABIN632528)

Target: CLPB (ClpB Caseinolytic Peptidase B Homolog (CLPB))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CLPB antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CLPB Antibody

Purification: Affinity purified

Immunogen: CLPB antibody was raised using a synthetic peptide corresponding to a region with amino acids QGGRFDTKCLAAATWGRLPGPEETLPGQDSWNGVPSRAGLGMCALAAALV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CLPB Blocking Peptide, (ABIN5612937), is also available for use as a blocking control in assays to test for specificity of this CLPB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLPB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CLPB

Target: CLPB (ClpB Caseinolytic Peptidase B Homolog (CLPB))

Alternative Name: CLPB

Background: CLPB belongs to the clpA/clpB family. It contains 4 ANK repeats. CLPB may function as a regulatory ATPase and be related to secretion/protein trafficking process.

Molecular Weight: 78 kDa (MW of target protein)