Acap3 antibody (N-Term)

Catalog No. ABIN632702

The Rabbit Polyclonal anti-Acap3 antibody has been validated for WB. It is suitable to detect Acap3 in samples from Human and Mouse.

Quick Overview for Acap3 antibody (N-Term) (ABIN632702)

Target: Acap3 (ArfGAP with Coiled-Coil, Ankyrin Repeat and PH Domains 3 (Acap3))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Acap3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Acap3 Antibody

Binding Specificity: N-Term

Specificity: CENTB5 antibody was raised against the N terminal of CENTB5

Purification: Affinity purified

Immunogen: CENTB5 antibody was raised using the N terminal of CENTB5 corresponding to a region with amino acids LQSFVKEDVRKFKETKKQFDKVREDLELSLVRNAQAPRHRPHEVEEATGA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CENTB5 Blocking Peptide, (ABIN5612823), is also available for use as a blocking control in assays to test for specificity of this CENTB5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENTB5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Acap3

Target: Acap3 (ArfGAP with Coiled-Coil, Ankyrin Repeat and PH Domains 3 (Acap3))

Alternative Name: CENTB5

Background: CENTB5 is a GTPase-activating protein for the ADP ribosylation factor family.

Molecular Weight: 85 kDa (MW of target protein)