C20orf141 antibody (Middle Region)

Catalog No. ABIN632707

This Rabbit Polyclonal antibody specifically detects C20orf141 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for C20orf141 antibody (Middle Region) (ABIN632707)

Target: C20orf141 (Chromosome 20 Open Reading Frame 141 (C20orf141))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C20orf141 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C20orf141 Antibody

Binding Specificity: Middle Region

Specificity: C20 ORF141 antibody was raised against the middle region of C20 rf141

Purification: Affinity purified

Immunogen: C20 ORF141 antibody was raised using the middle region of C20 rf141 corresponding to a region with amino acids HTLPQRKLLTRGQSQGAGEGPGQQEALLLQMGTVSGQLSLQDALLLLLMG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C20ORF141 Blocking Peptide, (ABIN939250), is also available for use as a blocking control in assays to test for specificity of this C20ORF141 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF141 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C20orf141

Target: C20orf141 (Chromosome 20 Open Reading Frame 141 (C20orf141))

Alternative Name: C20ORF141

Background: The function of C20orf141 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 17 kDa (MW of target protein)