KRT18P55 antibody (N-Term)

Catalog No. ABIN632836

This Rabbit Polyclonal antibody specifically detects KRT18P55 in WB. It exhibits reactivity toward Human.

Quick Overview for KRT18P55 antibody (N-Term) (ABIN632836)

Target: KRT18P55 (Keratin 18 Pseudogene 55 (KRT18P55))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KRT18P55 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KRT18P55 Antibody

Binding Specificity: N-Term

Specificity: FLJ40504 antibody was raised against the N terminal of FLJ40504

Purification: Affinity purified

Immunogen: FLJ40504 antibody was raised using the N terminal of FLJ40504 corresponding to a region with amino acids MDHCLISGLSQLDLPSALTKNWPSKPESCPLALLPGQHELHHLLHPLHQL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FLJ40504 Blocking Peptide, (ABIN5613616), is also available for use as a blocking control in assays to test for specificity of this FLJ40504 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FLJ40504 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KRT18P55

Target: KRT18P55 (Keratin 18 Pseudogene 55 (KRT18P55))

Alternative Name: FLJ40504

Background: The specific function of FFLJ40504 is not yet known.

Molecular Weight: 29 kDa (MW of target protein)