MFAP1 antibody (Middle Region)

Catalog No. ABIN632905

This Rabbit Polyclonal antibody specifically detects MFAP1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for MFAP1 antibody (Middle Region) (ABIN632905)

Target: MFAP1 (Microfibrillar Associated Protein 1 (MFAP1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MFAP1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MFAP1 Antibody

Binding Specificity: Middle Region

Specificity: MFAP1 antibody was raised against the middle region of MFAP1

Purification: Affinity purified

Immunogen: MFAP1 antibody was raised using the middle region of MFAP1 corresponding to a region with amino acids TKYTHLVDQDTTSFDSAWGQESAQNTKFFKQKAAGVRDVFERPSAKKRKT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MFAP1 Blocking Peptide, (ABIN5614734), is also available for use as a blocking control in assays to test for specificity of this MFAP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MFAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MFAP1

Target: MFAP1 (Microfibrillar Associated Protein 1 (MFAP1))

Alternative Name: MFAP1

Background: MFAP1 is a component of the elastin-associated microfibrils.

Molecular Weight: 52 kDa (MW of target protein)