UFSP2 antibody (Middle Region)

Catalog No. ABIN632946

This anti-UFSP2 antibody is a Rabbit Polyclonal antibody detecting UFSP2 in WB. Suitable for Human.

Quick Overview for UFSP2 antibody (Middle Region) (ABIN632946)

Target: UFSP2 (C4orf20) (Chromosome 4 Open Reading Frame 20 (C4orf20))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This UFSP2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-UFSP2 Antibody

Binding Specificity: Middle Region

Specificity: C4 ORF20 antibody was raised against the middle region of C4 rf20

Purification: Affinity purified

Immunogen: C4 ORF20 antibody was raised using the middle region of C4 rf20 corresponding to a region with amino acids YHHYMQDRIDDNGWGCAYRSLQTICSWFKHQGYTERSIPTHREIQQALVD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C4ORF20 Blocking Peptide, (ABIN936089), is also available for use as a blocking control in assays to test for specificity of this C4ORF20 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for UFSP2

Target: UFSP2 (C4orf20) (Chromosome 4 Open Reading Frame 20 (C4orf20))

Alternative Name: C4ORF20

Background: Ubiquitin-fold modifier-1 must be processed by a protease before it can conjugate with its target proteins. C4ORF20 is a thiol protease that specifically processes the C terminus of UFM1.

Molecular Weight: 53 kDa (MW of target protein)