UFSP2 antibody (Middle Region)
-
- Target See all UFSP2 (C4orf20) Antibodies
- UFSP2 (C4orf20) (Chromosome 4 Open Reading Frame 20 (C4orf20))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This UFSP2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- C4 ORF20 antibody was raised against the middle region of C4 rf20
- Purification
- Affinity purified
- Immunogen
- C4 ORF20 antibody was raised using the middle region of C4 rf20 corresponding to a region with amino acids YHHYMQDRIDDNGWGCAYRSLQTICSWFKHQGYTERSIPTHREIQQALVD
- Top Product
- Discover our top product C4orf20 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
C4ORF20 Blocking Peptide, catalog no. 33R-10125, is also available for use as a blocking control in assays to test for specificity of this C4ORF20 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF20 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- UFSP2 (C4orf20) (Chromosome 4 Open Reading Frame 20 (C4orf20))
- Alternative Name
- C4ORF20 (C4orf20 Products)
- Background
- Ubiquitin-fold modifier-1 must be processed by a protease before it can conjugate with its target proteins. C4ORF20 is a thiol protease that specifically processes the C terminus of UFM1.
- Molecular Weight
- 53 kDa (MW of target protein)
-