ARHGAP15 antibody (Middle Region)

Catalog No. ABIN632948

Product Details anti-ARHGAP15 Antibody

Target: ARHGAP15 (rho GTPase Activating Protein 15 (ARHGAP15))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ARHGAP15 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ARHGAP15 antibody was raised against the middle region of ARHGAP15

Purification: Affinity purified

Immunogen: ARHGAP15 antibody was raised using the middle region of ARHGAP15 corresponding to a region with amino acids VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ARHGAP15 Blocking Peptide, catalog no. 33R-9637, is also available for use as a blocking control in assays to test for specificity of this ARHGAP15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARHGAP15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ARHGAP15

Target: ARHGAP15 (rho GTPase Activating Protein 15 (ARHGAP15))

Alternative Name: ARHGAP15 (ARHGAP15 Products)

Background: RHO GTPases regulate diverse biologic processes, and their activity is regulated by RHO GTPase-activating proteins (GAPs), such as ARHGAP15.

Molecular Weight: 54 kDa (MW of target protein)