Proline Rich 18 antibody (N-Term)

Catalog No. ABIN632970

This anti-Proline Rich 18 antibody is a Rabbit Polyclonal antibody detecting Proline Rich 18 in WB. Suitable for Human.

Quick Overview for Proline Rich 18 antibody (N-Term) (ABIN632970)

Target: Proline Rich 18 (PRR18)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Proline Rich 18 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Proline Rich 18 Antibody

Binding Specificity: N-Term

Specificity: PRR18 antibody was raised against the N terminal of PRR18

Purification: Affinity purified

Immunogen: PRR18 antibody was raised using the N terminal of PRR18 corresponding to a region with amino acids RPPQRPEGLLSSSWPSATLKRPPARRGPGLDRTQPPAPPGVSPQALPSRA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRR18 Blocking Peptide, (ABIN5615594), is also available for use as a blocking control in assays to test for specificity of this PRR18 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRR18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Proline Rich 18

Target: Proline Rich 18 (PRR18)

Alternative Name: PRR18

Background: The function of PRR18 has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 31 kDa (MW of target protein)