C8orf45 antibody (Middle Region)

Catalog No. ABIN633137

The Rabbit Polyclonal anti-C8orf45 antibody has been validated for WB. It is suitable to detect C8orf45 in samples from Human.

Quick Overview for C8orf45 antibody (Middle Region) (ABIN633137)

Target: C8orf45 (Chromosome 8 Open Reading Frame 45 (C8orf45))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C8orf45 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C8orf45 Antibody

Binding Specificity: Middle Region

Specificity: C8 orf45 antibody was raised against the middle region of C8 rf45

Purification: Affinity purified

Immunogen: C8 orf45 antibody was raised using the middle region of C8 rf45 corresponding to a region with amino acids IQAGSALLAKGGICFIGDLASHKKDKLEQLQTVLESRSITVYIPGKKFGE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C8orf45 Blocking Peptide, (ABIN939493), is also available for use as a blocking control in assays to test for specificity of this C8orf45 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 rf45 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C8orf45

Target: C8orf45 (Chromosome 8 Open Reading Frame 45 (C8orf45))

Alternative Name: C8orf45

Background: The function of Chromosome 8 ORF protein is not widely studied, and is yet to be elucidated fully.

Molecular Weight: 65 kDa (MW of target protein)