PAGE4 antibody

Catalog No. ABIN633161

The Rabbit Polyclonal anti-PAGE4 antibody is suitable to detect PAGE4 in samples from Human. It has been validated for WB.

Quick Overview for PAGE4 antibody (ABIN633161)

Target: PAGE4 (P Antigen Family, Member 4 (Prostate Associated) (PAGE4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PAGE4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PAGE4 Antibody

Purification: Affinity purified

Immunogen: PAGE4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PPIEERKVEGDCQEMDLEKTRSERGDGSDVKEKTPPNPKHAKTKEAGDGQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PAGE4 Blocking Peptide, (ABIN5615193), is also available for use as a blocking control in assays to test for specificity of this PAGE4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAGE4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PAGE4

Target: PAGE4 (P Antigen Family, Member 4 (Prostate Associated) (PAGE4))

Alternative Name: PAGE4

Background: This gene is a member of the GAGE family. The GAGE genes are expressed in a variety of tumors and in some fetal and reproductive tissues. This gene is strongly expressed in prostate and prostate cancer, but is also expressed in other male and female reproductive tissues including testis, fallopian tube, uterus, and placenta, as well as in testicular cancer and uterine cancer. The protein encoded by this gene shares sequence similarity with other GAGE/PAGE proteins, and also belongs to a family of CT (cancer-testis) antigens.

Molecular Weight: 11 kDa (MW of target protein)