TNNI3 antibody

Catalog No. ABIN633170

The Rabbit Polyclonal anti-TNNI3 antibody has been validated for WB. It is suitable to detect TNNI3 in samples from Human, Mouse, Rat and Dog.

Quick Overview for TNNI3 antibody (ABIN633170)

Target: TNNI3 (Cardiac Troponin I (TNNI3))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TNNI3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TNNI3 Antibody

Purification: Affinity purified

Immunogen: Troponin I Type 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Troponin I Type 3 Blocking Peptide, (ABIN5616804), is also available for use as a blocking control in assays to test for specificity of this Troponin I Type 3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TNNI3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TNNI3

Target: TNNI3 (Cardiac Troponin I (TNNI3))

Background: Troponin I (TnI), along with troponin T (TnT) and troponin C (TnC), is one of 3 subunits that form the troponin complex of the thin filaments of striated muscle. TnI is the inhibitory subunit, blocking actin-myosin interactions and thereby mediating striated muscle relaxation. The TnI subfamily contains three genes: TnI-skeletal-fast-twitch, TnI-skeletal-slow-twitch, and TnI-cardiac. TNNI3 is the TnI-cardiac protein and is exclusively expressed in cardiac muscle tissues.

Molecular Weight: 23 kDa (MW of target protein)