RENT1/UPF1 antibody

Catalog No. ABIN633191

Product Details anti-RENT1/UPF1 Antibody

Target: RENT1/UPF1 (UPF1) (UPF1 Regulator of Nonsense Transcripts Homolog (UPF1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RENT1/UPF1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: UPF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RGTPKGKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

UPF1 Blocking Peptide, catalog no. 33R-7945, is also available for use as a blocking control in assays to test for specificity of this UPF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RENT1/UPF1

Target: RENT1/UPF1 (UPF1) (UPF1 Regulator of Nonsense Transcripts Homolog (UPF1))

Alternative Name: UPF1 (UPF1 Products)

Background: UPF1 is a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons.

Molecular Weight: 123 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome