DHX15 antibody

Catalog No. ABIN633262

This Rabbit Polyclonal antibody specifically detects DHX15 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for DHX15 antibody (ABIN633262)

Target: DHX15 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DHX15 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DHX15 Antibody

Purification: Affinity purified

Immunogen: DHX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids GHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DHX15 Blocking Peptide, (ABIN938703), is also available for use as a blocking control in assays to test for specificity of this DHX15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DHX15

Target: DHX15 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15))

Alternative Name: DHX15

Background: DHX15 is a putative ATP-dependent RNA helicase implicated in pre-mRNA splicing.

Molecular Weight: 91 kDa (MW of target protein)