DHX15 antibody
-
- Target See all DHX15 Antibodies
- DHX15 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This DHX15 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- DHX15 antibody was raised using a synthetic peptide corresponding to a region with amino acids GHTSLPQCINPFTNLPHTPRYYDILKKRLQLPVWEYKDRFTDILVRHQSF
- Top Product
- Discover our top product DHX15 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
DHX15 Blocking Peptide, catalog no. 33R-3317, is also available for use as a blocking control in assays to test for specificity of this DHX15 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DHX15 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- DHX15 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 15 (DHX15))
- Alternative Name
- DHX15 (DHX15 Products)
- Background
- DHX15 is a putative ATP-dependent RNA helicase implicated in pre-mRNA splicing.
- Molecular Weight
- 91 kDa (MW of target protein)
-