ZRSR2 antibody

Catalog No. ABIN633336

This anti-ZRSR2 antibody is a Rabbit Polyclonal antibody detecting ZRSR2 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for ZRSR2 antibody (ABIN633336)

Target: ZRSR2 (Zinc Finger (CCCH Type), RNA-Binding Motif and serine/arginine Rich 2 (ZRSR2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZRSR2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ZRSR2 Antibody

Purification: Affinity purified

Immunogen: ZRSR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKEQWEEQQRKEREEEEQKRQEKKEKEEALQKMLDQAENELENGTTWQNP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZRSR2 Blocking Peptide, (ABIN940470), is also available for use as a blocking control in assays to test for specificity of this ZRSR2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZRSR2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZRSR2

Target: ZRSR2 (Zinc Finger (CCCH Type), RNA-Binding Motif and serine/arginine Rich 2 (ZRSR2))

Alternative Name: ZRSR2

Background: ZRSR2 is an essential splicing factor. The protein associates with the U2 auxiliary factor heterodimer, which is required for the recognition of a functional 3' splice site in pre-mRNA splicing.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization