CSTF3 antibody (N-Term)
-
- Target See all CSTF3 Antibodies
- CSTF3 (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 3, 77kDa (CSTF3))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CSTF3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CSTF3 antibody was raised against the N terminal of CSTF3
- Purification
- Affinity purified
- Immunogen
- CSTF3 antibody was raised using the N terminal of CSTF3 corresponding to a region with amino acids YIEAEIKAKNYDKVEKLFQRCLMKVLHIDLWKCYLSYVRETKGKLPSYKE
- Top Product
- Discover our top product CSTF3 Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CSTF3 Blocking Peptide, catalog no. 33R-10133, is also available for use as a blocking control in assays to test for specificity of this CSTF3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSTF3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CSTF3 (Cleavage Stimulation Factor, 3' Pre-RNA, Subunit 3, 77kDa (CSTF3))
- Alternative Name
- CSTF3 (CSTF3 Products)
- Background
- CSTF3 is one of three (including CSTF1 and CSTF2) cleavage stimulation factors that combine to form the cleavage stimulation factor complex (CSTF). This complex is involved in the polyadenylation and 3' end cleavage of pre-mRNAs. The protein functions as a homodimer and interacts directly with both CSTF1 and CSTF2 in the CSTF complex.
- Molecular Weight
- 79 kDa (MW of target protein)
-