SFRS9 antibody (Middle Region)

Catalog No. ABIN633457

This Rabbit Polyclonal antibody specifically detects SFRS9 in WB. It exhibits reactivity toward Human, Mouse, Rat and C. elegans.

Quick Overview for SFRS9 antibody (Middle Region) (ABIN633457)

Target: SFRS9 (serine/arginine-Rich Splicing Factor 9 (SFRS9))

Reactivity: Human, Mouse, Rat, C. elegans

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SFRS9 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SFRS9 Antibody

Binding Specificity: Middle Region

Specificity: SFRS9 antibody was raised against the middle region of SFRS9

Purification: Affinity purified

Immunogen: SFRS9 antibody was raised using the middle region of SFRS9 corresponding to a region with amino acids VCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPER

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SFRS9 Blocking Peptide, (ABIN5616107), is also available for use as a blocking control in assays to test for specificity of this SFRS9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SFRS9

Target: SFRS9 (serine/arginine-Rich Splicing Factor 9 (SFRS9))

Alternative Name: SFRS9

Background: SFRS9 belongs to the splicing factor SR family. It contains 2 RRM (RNA recognition motif) domains. SFRS9 plays a role in constitutive splicing and can modulate the selection of alternative splice sites.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization