Deleted In Azoospermia 4 (DAZ4) (Middle Region) antibody

Details for Product No. ABIN633467
Antigen
Epitope
Middle Region
10
8
8
7
3
2
1
1
Reactivity
Human
52
19
19
4
3
3
2
2
2
2
Host
Rabbit
51
1
Clonality
Polyclonal
Conjugate
Un-conjugated
4
3
3
2
2
2
2
2
2
2
2
2
1
1
1
1
1
Application
Western Blotting (WB)
33
24
19
13
8
1
1
Options
Immunogen DAZ4 antibody was raised using the middle region of DAZ4 corresponding to a region with amino acids ITGCQLLVYNYQEYPTYPDSAFQVTTGYQLPVYNYQPFPAYPRSPFQVTA
Specificity DAZ4 antibody was raised against the middle region of DAZ4
Purification Affinity purified
Antigen
Alternative Name DAZ4 (DAZ4 Antibody Abstract)
Background This gene is a member of the DAZ gene family and is a candidate for the human Y-chromosomal azoospermia factor (AZF). This RNA-binding protein is important for spermatogenesis.
Molecular Weight 44 kDa (MW of target protein)
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

DAZ4 Blocking Peptide, catalog no. 33R-4176, is also available for use as a blocking control in assays to test for specificity of this DAZ4 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DAZ4 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Image no. 1 for anti-Deleted In Azoospermia 4 (DAZ4) (Middle Region) antibody (ABIN633467) DAZ4 antibody used at 1 ug/ml to detect target protein.