NSF antibody (C-Term)

Catalog No. ABIN633516

This anti-NSF antibody is a Rabbit Polyclonal antibody detecting NSF in WB. Suitable for Human, Rat and Mouse.

Quick Overview for NSF antibody (C-Term) (ABIN633516)

Target: NSF (N-Ethylmaleimide-Sensitive Factor (NSF))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NSF antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NSF Antibody

Binding Specificity: C-Term

Specificity: NSF antibody was raised against the C terminal of NSF

Purification: Affinity purified

Immunogen: NSF antibody was raised using the C terminal of NSF corresponding to a region with amino acids STTIHVPNIATGEQLLEALELLGNFKDKERTTIAQQVKGKKVWIGIKKLL

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NSF Blocking Peptide, (ABIN5615065), is also available for use as a blocking control in assays to test for specificity of this NSF antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NSF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NSF

Target: NSF (N-Ethylmaleimide-Sensitive Factor (NSF))

Alternative Name: NSF

Background: NSF is required for vesicle-mediated transport. NSF catalyzes the fusion of transport vesicles within the Golgi cisternae. It is s also required for transport from the endoplasmic reticulum to the Golgi stack. NSF seems to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin.

Molecular Weight: 33 kDa (MW of target protein)