RBM12 antibody (Middle Region)

Catalog No. ABIN633603

This anti-RBM12 antibody is a Rabbit Polyclonal antibody detecting RBM12 in WB. Suitable for Human.

Quick Overview for RBM12 antibody (Middle Region) (ABIN633603)

Target: RBM12 (RNA Binding Motif Protein 12 (RBM12))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RBM12 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RBM12 Antibody

Binding Specificity: Middle Region

Specificity: RBM12 antibody was raised against the middle region of RBM12

Purification: Affinity purified

Immunogen: RBM12 antibody was raised using the middle region of RBM12 corresponding to a region with amino acids VLVDNNGQGLGQALVQFKNEDDARKSERLHRKKLNGREAFVHVVTLEDMR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBM12 Blocking Peptide, (ABIN5615780), is also available for use as a blocking control in assays to test for specificity of this RBM12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBM12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RBM12

Target: RBM12 (RNA Binding Motif Protein 12 (RBM12))

Alternative Name: RBM12

Background: RBM12 contains several RNA-binding motifs, potential transmembrane domains, and proline-rich regions. The function of RBM12 remains unknown.

Molecular Weight: 97 kDa (MW of target protein)