VDAC2 antibody (N-Term)

Catalog No. ABIN633626

Product Details anti-VDAC2 Antibody

Target: VDAC2 (Voltage-Dependent Anion Channel 2 (VDAC2))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This VDAC2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: VDAC2 antibody was raised against the N terminal of VDAC2

Purification: Affinity purified

Immunogen: VDAC2 antibody was raised using the N terminal of VDAC2 corresponding to a region with amino acids MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGV

Application Details

Application Notes: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

VDAC2 Blocking Peptide, catalog no. 33R-5772, is also available for use as a blocking control in assays to test for specificity of this VDAC2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VDAC2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for VDAC2

Target: VDAC2 (Voltage-Dependent Anion Channel 2 (VDAC2))

Alternative Name: VDAC2 (VDAC2 Products)

Background: VDAC2 forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective.

Molecular Weight: 32 kDa (MW of target protein)