SCN5A antibody (C-Term)
-
- Target See all SCN5A Antibodies
- SCN5A (Sodium Channel, Voltage-Gated, Type V, alpha Subunit (SCN5A))
-
Binding Specificity
- C-Term
-
Reactivity
- Human, Mouse, Rat, Dog, Zebrafish (Danio rerio)
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SCN5A antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- SCN5 A antibody was raised against the C terminal of SCN5
- Purification
- Affinity purified
- Immunogen
- SCN5 A antibody was raised using the C terminal of SCN5 corresponding to a region with amino acids FTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAM
- Top Product
- Discover our top product SCN5A Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SCN5A Blocking Peptide, catalog no. 33R-3093, is also available for use as a blocking control in assays to test for specificity of this SCN5A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCN0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SCN5A (Sodium Channel, Voltage-Gated, Type V, alpha Subunit (SCN5A))
- Alternative Name
- SCN5A (SCN5A Products)
- Background
- SCN5A is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. The protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram.
- Molecular Weight
- 222 kDa (MW of target protein)
-