SCN5A antibody (N-Term)
-
- Target See all SCN5A Antibodies
- SCN5A (Sodium Channel, Voltage-Gated, Type V, alpha Subunit (SCN5A))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SCN5A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SCN5 A antibody was raised against the N terminal of SCN5
- Purification
- Affinity purified
- Immunogen
- SCN5 A antibody was raised using the N terminal of SCN5 corresponding to a region with amino acids SEADFADDENSTAGESESHHTSLLVPWPLRRTSAQGQPSPGTSAPGHALH
- Top Product
- Discover our top product SCN5A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SCN5A Blocking Peptide, catalog no. 33R-8381, is also available for use as a blocking control in assays to test for specificity of this SCN5A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCN0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SCN5A (Sodium Channel, Voltage-Gated, Type V, alpha Subunit (SCN5A))
- Alternative Name
- SCN5A (SCN5A Products)
- Synonyms
- Nav1.5 antibody, Nav1.5c antibody, SkM1 antibody, SkM2 antibody, mH1 antibody, CDCD2 antibody, CMD1E antibody, CMPD2 antibody, HB1 antibody, HB2 antibody, HBBD antibody, HH1 antibody, ICCD antibody, IVF antibody, LQT3 antibody, PFHB1 antibody, SSS1 antibody, VF1 antibody, SCAL antibody, sodium voltage-gated channel alpha subunit 5 antibody, sodium channel, voltage-gated, type V, alpha antibody, SCN5A antibody, Scn5a antibody
- Background
- SCN5A is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. The protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram.
- Molecular Weight
- 227 kDa (MW of target protein)
-