KCNG4 antibody (N-Term)
-
- Target See all KCNG4 (Kcng4) Antibodies
- KCNG4 (Kcng4) (Potassium Voltage-Gated Channel, Subfamily G, Member 4 (Kcng4))
-
Binding Specificity
- N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This KCNG4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- KCNG4 antibody was raised against the N terminal of KCNG4
- Purification
- Affinity purified
- Immunogen
- KCNG4 antibody was raised using the N terminal of KCNG4 corresponding to a region with amino acids QEELAYWGIEEAHLERCCLRKLLRKLEELEELAKLHREDVLRQQRETRRP
- Top Product
- Discover our top product Kcng4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
KCNG4 Blocking Peptide, catalog no. 33R-7518, is also available for use as a blocking control in assays to test for specificity of this KCNG4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNG4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- KCNG4 (Kcng4) (Potassium Voltage-Gated Channel, Subfamily G, Member 4 (Kcng4))
- Alternative Name
- KCNG4 (Kcng4 Products)
- Background
- Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG4 is a member of the potassium channel, voltage-gated, subfamily G. This member functions as a modulatory subunit. The protein has strong expression in brain.
- Molecular Weight
- 59 kDa (MW of target protein)
-