Glucose-6-Phosphate Dehydrogenase antibody

Catalog No. ABIN633920

Product Details anti-Glucose-6-Phosphate Dehydrogenase Antibody

Target: Glucose-6-Phosphate Dehydrogenase (G6PD)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Glucose-6-Phosphate Dehydrogenase antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: H6 PD antibody was raised using a synthetic peptide corresponding to a region with amino acids HFSAQQLATELGTFFQEEEMYRVDHYLGKQAVAQILPFRDQNRKALDGLW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

H6PD Blocking Peptide, catalog no. 33R-3729, is also available for use as a blocking control in assays to test for specificity of this H6PD antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of H0 D antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Glucose-6-Phosphate Dehydrogenase

Target: Glucose-6-Phosphate Dehydrogenase (G6PD)

Alternative Name: H6PD (G6PD Products)

Background: There are 2 forms of glucose-6-phosphate dehydrogenase. G form is X-linked and H form is autosomally linked. This H form shows activity with other hexose-6-phosphates, especially galactose-6-phosphate, whereas the G form is specific for glucose-6-phosphate. Both forms are present in most tissues, but H form is not found in red cells.

Molecular Weight: 89 kDa (MW of target protein)

Pathways: Regulation of Systemic Arterial Blood Pressure by Hormones