Fibulin 1 antibody (N-Term)

Catalog No. ABIN633929

The Rabbit Polyclonal anti-Fibulin 1 antibody has been validated for WB. It is suitable to detect Fibulin 1 in samples from Human and Rat.

Quick Overview for Fibulin 1 antibody (N-Term) (ABIN633929)

Target: Fibulin 1 (FBLN1)

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Fibulin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Fibulin 1 Antibody

Binding Specificity: N-Term

Specificity: FBLN1 antibody was raised against the N terminal of FBLN1

Purification: Affinity purified

Immunogen: FBLN1 antibody was raised using the N terminal of FBLN1 corresponding to a region with amino acids CCVKSQETGDLDVGGLQETDKIIEVEEEQEDPYLNDRCRGGGPCKQQCRD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FBLN1 Blocking Peptide, (ABIN937043), is also available for use as a blocking control in assays to test for specificity of this FBLN1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBLN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Fibulin 1

Target: Fibulin 1 (FBLN1)

Alternative Name: FBLN1

Background: Fibulin 1 is a secreted glycoprotein that becomes incorporated into a fibrillar extracellular matrix. Calcium-binding is apparently required to mediate its binding to laminin and nidogen. It mediates platelet adhesion via binding fibrinogen.

Molecular Weight: 72 kDa (MW of target protein)