SERPINA5 antibody

Catalog No. ABIN633990

This anti-SERPINA5 antibody is a Rabbit Polyclonal antibody detecting SERPINA5 in WB. Suitable for Human.

Quick Overview for SERPINA5 antibody (ABIN633990)

Target: SERPINA5 (serpin Peptidase Inhibitor, Clade A (Alpha-1 Antiproteinase, Antitrypsin), Member 5 (SERPINA5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SERPINA5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SERPINA5 Antibody

Purification: Affinity purified

Immunogen: SERPINA5 antibody was raised using a synthetic peptide corresponding to a region with amino acids VFTSHADLSGISNHSNIQVSEMVHKAVVEVDESGTRAAAATGTIFTFRSA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SERPINA5 Blocking Peptide, (ABIN5616063), is also available for use as a blocking control in assays to test for specificity of this SERPINA5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINA5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SERPINA5

Target: SERPINA5 (serpin Peptidase Inhibitor, Clade A (Alpha-1 Antiproteinase, Antitrypsin), Member 5 (SERPINA5))

Alternative Name: SERPINA5

Background: SERPINA5 belongs to the serpin family. It Inhibits activated protein C as well as plasminogen activators.

Molecular Weight: 45 kDa (MW of target protein)