LYPD6 antibody (Middle Region)

Catalog No. ABIN633991

This Rabbit Polyclonal antibody specifically detects LYPD6 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for LYPD6 antibody (Middle Region) (ABIN633991)

Target: LYPD6 (LY6/PLAUR Domain Containing 6 (LYPD6))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LYPD6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LYPD6 Antibody

Binding Specificity: Middle Region

Specificity: LYPD6 antibody was raised against the middle region of LYPD6

Purification: Affinity purified

Immunogen: LYPD6 antibody was raised using the middle region of LYPD6 corresponding to a region with amino acids RDSEHEGHKVCTSCCEGNICNLPLPRNETDATFATTSPINQTNGHPRCMS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LYPD6 Blocking Peptide, (ABIN5614612), is also available for use as a blocking control in assays to test for specificity of this LYPD6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LYPD6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LYPD6

Target: LYPD6 (LY6/PLAUR Domain Containing 6 (LYPD6))

Alternative Name: LYPD6

Background: LYPD6 contains 1 UPAR/Ly6 domain. The exact function of LYPD6 is not known.

Molecular Weight: 19 kDa (MW of target protein)