Haptoglobin antibody (N-Term)

Catalog No. ABIN634032

This anti-Haptoglobin antibody is a Rabbit Polyclonal antibody detecting Haptoglobin in WB. Suitable for Human.

Quick Overview for Haptoglobin antibody (N-Term) (ABIN634032)

Target: Haptoglobin (HP)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Haptoglobin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Haptoglobin Antibody

Binding Specificity: N-Term

Specificity: Haptoglobin antibody was raised against the N terminal of HP

Purification: Affinity purified

Immunogen: Haptoglobin antibody was raised using the N terminal of HP corresponding to a region with amino acids MSALGAVIALLLWGQLFAVDSGNDVTDIADDGCPKPPEIAHGYVEHSVRY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Haptoglobin Blocking Peptide, (ABIN5613925), is also available for use as a blocking control in assays to test for specificity of this Haptoglobin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Haptoglobin

Target: Haptoglobin (HP)

Alternative Name: Haptoglobin

Background: Haptoglobin combines with free plasma hemoglobin, preventing loss of iron through the kidneys and protecting the kidneys from damage by hemoglobin, while making the hemoglobin accessible to degradative enzymes.

Molecular Weight: 45 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis