SERPINA5 antibody (C-Term)
-
- Target See all SERPINA5 Antibodies
- SERPINA5 (serpin Peptidase Inhibitor, Clade A (Alpha-1 Antiproteinase, Antitrypsin), Member 5 (SERPINA5))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SERPINA5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SERPINA5 antibody was raised against the C terminal of SERPINA5
- Purification
- Affinity purified
- Immunogen
- SERPINA5 antibody was raised using the C terminal of SERPINA5 corresponding to a region with amino acids LPSEGKMQQVENGLSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVL
- Top Product
- Discover our top product SERPINA5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SERPINA5 Blocking Peptide, catalog no. 33R-5288, is also available for use as a blocking control in assays to test for specificity of this SERPINA5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINA5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SERPINA5 (serpin Peptidase Inhibitor, Clade A (Alpha-1 Antiproteinase, Antitrypsin), Member 5 (SERPINA5))
- Alternative Name
- SERPINA5 (SERPINA5 Products)
- Background
- SERPINA5 belongs to the serpin family. It Inhibits activated protein C as well as plasminogen activators.
- Molecular Weight
- 45 kDa (MW of target protein)
-