LCN12 antibody (N-Term)

Catalog No. ABIN634058

The Rabbit Polyclonal anti-LCN12 antibody has been validated for WB. It is suitable to detect LCN12 in samples from Human.

Quick Overview for LCN12 antibody (N-Term) (ABIN634058)

Target: LCN12 (Lipocalin 12 (LCN12))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LCN12 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LCN12 Antibody

Binding Specificity: N-Term

Specificity: Lipocalin 12 antibody was raised against the N terminal of LCN12

Purification: Affinity purified

Immunogen: Lipocalin 12 antibody was raised using the N terminal of LCN12 corresponding to a region with amino acids GNQFQGEWFVLGLAGNSFRPEHRALLNAFTATFELSDDGRFEVWNAMTRG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Lipocalin 12 Blocking Peptide, (ABIN938840), is also available for use as a blocking control in assays to test for specificity of this Lipocalin 12 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCN12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LCN12

Target: LCN12 (Lipocalin 12 (LCN12))

Alternative Name: Lipocalin 12

Background: LCN12 may play a role in male fertility. LCN12 may act as a retinoid carrier protein within the epididymis.

Molecular Weight: 39 kDa (MW of target protein)