RRM2 antibody (N-Term)

Catalog No. ABIN634182

This anti-RRM2 antibody is a Rabbit Polyclonal antibody detecting RRM2 in WB. Suitable for Human.

Quick Overview for RRM2 antibody (N-Term) (ABIN634182)

Target: RRM2 (Ribonucleotide Reductase M2 (RRM2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RRM2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RRM2 Antibody

Binding Specificity: N-Term

Specificity: RRM2 antibody was raised against the N terminal of RRM2

Purification: Affinity purified

Immunogen: RRM2 antibody was raised using the N terminal of RRM2 corresponding to a region with amino acids PALSGTRVLASKTARRIFQEPTEPKTKAAAPGVEDEPLLRENPRRFVIFP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RRM2 Blocking Peptide, (ABIN5615963), is also available for use as a blocking control in assays to test for specificity of this RRM2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RRM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RRM2

Target: RRM2 (Ribonucleotide Reductase M2 (RRM2))

Alternative Name: RRM2

Background: RRM2 provides the precursors necessary for DNA synthesis. RRM2 catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. RRM2 inhibits Wnt signaling.Ribonucleotide reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. It is composed of 2 non-identical subunits, proteins M1 and M2. Synthesis of M2 is regulated in a cell-cycle dependent fashion.

Molecular Weight: 45 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases