PP5 antibody (N-Term)

Catalog No. ABIN634245

This anti-PP5 antibody is a Rabbit Polyclonal antibody detecting PP5 in WB. Suitable for Human and Mouse.

Quick Overview for PP5 antibody (N-Term) (ABIN634245)

Target: PP5 (PPP5C) (Protein Phosphatase 5, Catalytic Subunit (PPP5C))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PP5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PP5 Antibody

Binding Specificity: N-Term

Specificity: PPP5 C antibody was raised against the N terminal of PPP5

Purification: Affinity purified

Immunogen: PPP5 C antibody was raised using the N terminal of PPP5 corresponding to a region with amino acids MAMAEGERTECAEPPRDEPPADGALKRAEELKTQANDYFKAKDYENAIKF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PPP5C Blocking Peptide, (ABIN5615528), is also available for use as a blocking control in assays to test for specificity of this PPP5C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PP5

Target: PP5 (PPP5C) (Protein Phosphatase 5, Catalytic Subunit (PPP5C))

Alternative Name: PPP5C

Background: PPP5C may play a role in the regulation of RNA biogenesis and/or mitosis. In vitro, PPP5C dephosphorylates serine residues of skeletal muscle phosphorylase and histone H1.

Molecular Weight: 57 kDa (MW of target protein)