PARD3 antibody

Catalog No. ABIN634251

Product Details anti-PARD3 Antibody

Target: PARD3 (Par-3 Partitioning Defective 3 Homolog (PARD3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PARD3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PARD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids EQQMKKQPPSEGPSNYDSYKKVQDPSYAPPKGPFRQDVPPSPSQVARLNR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PARD3 Blocking Peptide, catalog no. 33R-2675, is also available for use as a blocking control in assays to test for specificity of this PARD3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARD3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PARD3

Target: PARD3 (Par-3 Partitioning Defective 3 Homolog (PARD3))

Alternative Name: PARD3 (PARD3 Products)

Background: PARD proteins, which were first identified in C. elegans, are essential for asymmetric cell division and polarized growth, whereas CDC42 mediates the establishment of cell polarity. The CDC42 GTPase, which is controlled by nucleotide exchange.

Molecular Weight: 151 kDa (MW of target protein)

Pathways: Cell-Cell Junction Organization