CD40 antibody (N-Term)

Catalog No. ABIN634498

This Rabbit Polyclonal antibody specifically detects CD40 in WB. It exhibits reactivity toward Human.

Quick Overview for CD40 antibody (N-Term) (ABIN634498)

Target: CD40

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CD40 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CD40 Antibody

Binding Specificity: N-Term

Specificity: CD40 antibody was raised against the N terminal of CD40

Purification: Affinity purified

Immunogen: CD40 antibody was raised using the N terminal of CD40 corresponding to a region with amino acids SQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CD40 Blocking Peptide, (ABIN5612754), is also available for use as a blocking control in assays to test for specificity of this CD40 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CD40

Target: CD40

Alternative Name: CD40

Background: CD40 is the receptor for TNFSF5/CD40LG. Defects in CD40 are the cause of hyper-IgM immunodeficiency type 3 (HIGM3).

Molecular Weight: 20 kDa (MW of target protein)

Pathways: NF-kappaB Signaling, Cellular Response to Molecule of Bacterial Origin, M Phase, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Production of Molecular Mediator of Immune Response, Cancer Immune Checkpoints