Heme Oxygenase antibody

Catalog No. ABIN634566

This anti-Heme Oxygenase antibody is a Rabbit Polyclonal antibody detecting Heme Oxygenase in WB. Suitable for Human, Mouse and Rat.

Quick Overview for Heme Oxygenase antibody (ABIN634566)

Target: Heme Oxygenase (HMOX)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Application: Western Blotting (WB)

Product Details anti-Heme Oxygenase Antibody

Purification: Affinity purified

Immunogen: Heme Oxygenase antibody was raised using a synthetic peptide corresponding to a region with amino acids ERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Heme Oxygenase Blocking Peptide, (ABIN938094), is also available for use as a blocking control in assays to test for specificity of this Heme Oxygenase antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HMOX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Heme Oxygenase

Target: Heme Oxygenase (HMOX)

Alternative Name: Heme Oxygenase

Background: HMOX1 belongs to the heme oxygenase family. Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter.

Molecular Weight: 33 kDa (MW of target protein)