NID2 antibody

Catalog No. ABIN634637

The Rabbit Polyclonal anti-NID2 antibody has been validated for WB. It is suitable to detect NID2 in samples from Human.

Quick Overview for NID2 antibody (ABIN634637)

Target: NID2 (Nidogen 2 (NID2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NID2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NID2 Antibody

Purification: Affinity purified

Immunogen: NID2 antibody was raised using a synthetic peptide corresponding to a region with amino acids DDLGHFIPLQCHGKSDFCWCVDKDGREVQGTRSQPGTTPACIPTVAPPMV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

NID2 Blocking Peptide, (ABIN937267), is also available for use as a blocking control in assays to test for specificity of this NID2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NID2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for NID2

Target: NID2 (Nidogen 2 (NID2))

Alternative Name: NID2

Background: Basement membranes, which are composed of type IV collagens, laminins, perlecan, and nidogen, are thin pericellular protein matrices that control a large number of cellular activities, including adhesion, migration, differentiation, gene expression, and apoptosis.

Molecular Weight: 148 kDa (MW of target protein)