Claudin 5 antibody
-
- Target See all Claudin 5 (CLDN5) Antibodies
- Claudin 5 (CLDN5)
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This Claudin 5 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- Claudin 5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKN
- Top Product
- Discover our top product CLDN5 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
Claudin 5 Blocking Peptide, catalog no. 33R-3663, is also available for use as a blocking control in assays to test for specificity of this Claudin 5 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN5 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Claudin 5 (CLDN5)
- Alternative Name
- Claudin 5 (CLDN5 Products)
- Background
- CLDN5 is a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome.
- Molecular Weight
- 23 kDa (MW of target protein)
- Pathways
- Hepatitis C
-