Claudin 5 antibody

Catalog No. ABIN634710

This anti-Claudin 5 antibody is a Rabbit Polyclonal antibody detecting Claudin 5 in WB. Suitable for Human.

Quick Overview for Claudin 5 antibody (ABIN634710)

Target: Claudin 5 (CLDN5)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Claudin 5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Claudin 5 Antibody

Purification: Affinity purified

Immunogen: Claudin 5 antibody was raised using a synthetic peptide corresponding to a region with amino acids GWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Claudin 5 Blocking Peptide, (ABIN939049), is also available for use as a blocking control in assays to test for specificity of this Claudin 5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDN5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Claudin 5

Target: Claudin 5 (CLDN5)

Alternative Name: Claudin 5

Background: CLDN5 is a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome.

Molecular Weight: 23 kDa (MW of target protein)

Pathways: Hepatitis C