SIGLEC6 antibody (C-Term)

Catalog No. ABIN634758

This anti-SIGLEC6 antibody is a Rabbit Polyclonal antibody detecting SIGLEC6 in WB. Suitable for Human.

Quick Overview for SIGLEC6 antibody (C-Term) (ABIN634758)

Target: SIGLEC6 (Sialic Acid Binding Ig-Like Lectin 6 (SIGLEC6))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SIGLEC6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SIGLEC6 Antibody

Binding Specificity: C-Term

Specificity: SIGLEC6 antibody was raised against the C terminal of SIGLEC6

Purification: Affinity purified

Immunogen: SIGLEC6 antibody was raised using the C terminal of SIGLEC6 corresponding to a region with amino acids IVSDHPAEAGPISEDEQELHYAVLHFHKVQPQEPKVTDTEYSEIKIHK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SIGLEC6 Blocking Peptide, (ABIN939594), is also available for use as a blocking control in assays to test for specificity of this SIGLEC6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SIGLEC6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SIGLEC6

Target: SIGLEC6 (Sialic Acid Binding Ig-Like Lectin 6 (SIGLEC6))

Alternative Name: SIGLEC6

Background: SIGLEC6 is a Putative adhesion molecule that mediates sialic-acid dependent binding to cells. It binds to alpha-2,6-linked sialic acid. The sialic acid recognition site may be masked by cis interactions with sialic acids on the same cell surface.

Molecular Weight: 47 kDa (MW of target protein)