CD5 antibody (N-Term)

Catalog No. ABIN634761

This anti-CD5 antibody is a Rabbit Polyclonal antibody detecting CD5 in WB. Suitable for Human.

Quick Overview for CD5 antibody (N-Term) (ABIN634761)

Target: CD5

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CD5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CD5 Antibody

Binding Specificity: N-Term

Specificity: CD5 antibody was raised against the N terminal of CD5

Purification: Affinity purified

Immunogen: CD5 antibody was raised using the N terminal of CD5 corresponding to a region with amino acids MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CD5 Blocking Peptide, (ABIN5612760), is also available for use as a blocking control in assays to test for specificity of this CD5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CD5

Target: CD5

Alternative Name: CD5

Background: CD5 may act as a receptor in regulating T-cell proliferation. CD5 interacts with CD72/LYB-2.

Molecular Weight: 54 kDa (MW of target protein)