PODXL antibody (Middle Region)
-
- Target See all PODXL Antibodies
- PODXL (Podocalyxin-Like (PODXL))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PODXL antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PODXL antibody was raised against the middle region of PODXL
- Purification
- Affinity purified
- Immunogen
- PODXL antibody was raised using the middle region of PODXL corresponding to a region with amino acids PATALRTPTLPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQ
- Top Product
- Discover our top product PODXL Primary Antibody
-
anti-Podocalyxin-Like (PODXL) antibody
PODXL Reactivity: Human WB, IHC, ELISA, FACS, IP, IF Host: Mouse Monoclonal 4D2G7 unconjugated
anti-Podocalyxin-Like (PODXL) (Extracellular Domain) antibodyPODXL Reactivity: Human, Rat, Rabbit WB, IHC, FACS, IP, IF, StM Host: Mouse Monoclonal 3D3 unconjugated
anti-Podocalyxin-Like (PODXL) (AA 32-458) antibodyPODXL Reactivity: Human WB, IHC, ELISA, IF Host: Rabbit Polyclonal unconjugated
anti-Podocalyxin-Like (PODXL) antibodyPODXL Reactivity: Human WB, IHC, ELISA, FACS Host: Mouse Monoclonal 5F5 unconjugated
anti-Podocalyxin-Like (PODXL) (AA 220-431) antibodyPODXL Reactivity: Human WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Podocalyxin-Like (PODXL) (AA 171-404) antibodyPODXL Reactivity: Mouse WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Podocalyxin-Like (PODXL) (AA 310-447) antibodyPODXL Reactivity: Human IHC, StM Host: Mouse Monoclonal PODXL-2185 unconjugated
anti-Podocalyxin-Like (PODXL) (AA 153-386) antibodyPODXL Reactivity: Rat WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Podocalyxin-Like (PODXL) (AA 408-485) antibodyPODXL Reactivity: Rat WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Podocalyxin-Like (PODXL) (AA 451-558) antibodyPODXL Reactivity: Human, Rat, Mouse WB, ELISA, FACS, IHC (p), IF (p), IHC (fro), IF (cc) Host: Rabbit Polyclonal unconjugated
-
- Application Notes
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PODXL Blocking Peptide, catalog no. 33R-6983, is also available for use as a blocking control in assays to test for specificity of this PODXL antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PODXL antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PODXL (Podocalyxin-Like (PODXL))
- Alternative Name
- PODXL (PODXL Products)
- Background
- PODXL is a member of the sialomucin protein family. PODXL was originally identified as an important component of glomerular podocytes. Podocytes are highly differentiated epithelial cells with interdigitating foot processes covering the outer aspect of the glomerular basement membrane. Other biological activities of the protein include: binding in a membrane protein complex with Na+/H+ exchanger regulatory factor to intracellular cytoskeletal elements, playing a role in hematopoetic cell differentiation, and being expressed in vascular endothelium cells and binding to L-selectin.
- Molecular Weight
- 56 kDa (MW of target protein)
- Pathways
- Tube Formation
-
