DNASE1 antibody (N-Term)

Catalog No. ABIN634872

This anti-DNASE1 antibody is a Rabbit Polyclonal antibody detecting DNASE1 in WB. Suitable for Human.

Quick Overview for DNASE1 antibody (N-Term) (ABIN634872)

Target: DNASE1 (Deoxyribonuclease I (DNASE1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DNASE1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DNASE1 Antibody

Binding Specificity: N-Term

Specificity: DNASE1 antibody was raised against the N terminal of DNASE1

Purification: Affinity purified

Immunogen: DNASE1 antibody was raised using the N terminal of DNASE1 corresponding to a region with amino acids GKLLDNLNQDAPDTYHYVVSEPLGRNSYKERYLFVYRPDQVSAVDSYYYD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DNASE1 Blocking Peptide, (ABIN938757), is also available for use as a blocking control in assays to test for specificity of this DNASE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNASE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DNASE1

Target: DNASE1 (Deoxyribonuclease I (DNASE1))

Alternative Name: DNASE1

Background: This gene encodes a member of the DNase family. This protein is stored in the zymogen granules of the nuclear envelope and functions by cleaving DNA in an endonucleolytic manner. At least six autosomal codominant alleles have been characterized.

Molecular Weight: 29 kDa (MW of target protein)