ZDHHC19 antibody (N-Term)

Catalog No. ABIN634916

The Rabbit Polyclonal anti-ZDHHC19 antibody has been validated for WB. It is suitable to detect ZDHHC19 in samples from Human.

Quick Overview for ZDHHC19 antibody (N-Term) (ABIN634916)

Target: ZDHHC19 (Zinc Finger, DHHC-Type Containing 19 (ZDHHC19))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZDHHC19 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ZDHHC19 Antibody

Binding Specificity: N-Term

Specificity: ZDHHC19 antibody was raised against the N terminal of ZDHHC19

Purification: Affinity purified

Immunogen: ZDHHC19 antibody was raised using the N terminal of ZDHHC19 corresponding to a region with amino acids TLLTDATPLVKEPHPLPLVPRPWFLPSLFAAFNVVLLVFFSGLFFAFPCR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ZDHHC19 Blocking Peptide, (ABIN5617094), is also available for use as a blocking control in assays to test for specificity of this ZDHHC19 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZDHHC19 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ZDHHC19

Target: ZDHHC19 (Zinc Finger, DHHC-Type Containing 19 (ZDHHC19))

Alternative Name: ZDHHC19

Background: ZDHHC19 belongs to the DHHC palmitoyltransferase family. It contains 1 DHHC-type zinc finger. ZDHHC19 is a multi-pass membrane protein. The function of the ZDHHC19 protein is not known.

Molecular Weight: 34 kDa (MW of target protein)