FJX1 antibody

Catalog No. ABIN634941

This anti-FJX1 antibody is a Rabbit Polyclonal antibody detecting FJX1 in WB. Suitable for Human, Rat and Mouse.

Quick Overview for FJX1 antibody (ABIN634941)

Target: FJX1 (Four Jointed Box 1 (FJX1))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FJX1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FJX1 Antibody

Purification: Affinity purified

Immunogen: FJX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MVALERGGCGRSSNRLARFADGTRACVRYGINPEQIQGEALSYYLARLLG

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FJX1 Blocking Peptide, (ABIN5613592), is also available for use as a blocking control in assays to test for specificity of this FJX1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FJX1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FJX1

Target: FJX1 (Four Jointed Box 1 (FJX1))

Alternative Name: FJX1

Background: FJX1 is the human ortholog of mouse and Drosophila four-jointed gene product. The Drosophila protein is important for growth and differentiation of legs and wings, and for proper development of the eyes. The exact function of FJX1 gene in humans is not known.

Molecular Weight: 48 kDa (MW of target protein)